 |
Database of Interacting Proteins
|
|
|
|
|
|
|
The DIP database provides access to the interaction and sequence data in
a variety of formats:
| PSI-MI (MIF) |
- |
Molecular Interaction XML Format
co-developed by us and other interaction data providers participating in the
HUPO Proteomics Standards Initiative (HUPO-PSI)
is a rich, XML-based format that can be used to describe interactions between a wide
range of molecular types, for example nucleic acids, chemical entities, and molecular
complexes. It can capture extensive details about each supported molecular interaction,
including the biological and experimental role of each molecule within that interaction
and detailed description of interacting domains.
We provide access to the sets of
original curation records
created by DIP curators according to the IMEx curation rules. These, together with the records
imported from other active members of the IMEx consortium, constitute the primary,
most complete set of the DIP experimental data. In addition, we generate number of files
(FULL,
SPECIES)
that organize experimental information about protein-protein interactions known to DIP
into species-specific datasets of varying confidence.
|
| MITAB2.5 |
- |
MITAB is a simpler,
tab-delimited format developed within the
HUPO Proteomics Standards Initiative (HUPO-PSI)
for the benefit of users who require only minimal information in an easy to access
configuration.
|
| FASTA |
- |
Sequences of the proteins participating in interactions reported by DIP are
provided in the form of FASTA
files. The sequence of each protein, together with its DIP, RefSeq and Uniprot accessions
is presented as a modified FASTA entry:
>dip:DIP-310N|refseq:NP_116614|uniprot:P60010
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGI
VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG
IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQ
EMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS
GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
|
|
XIN (legacy) |
- |
This is a legacy XML format that was used before introduction of PSI-MI (MIF).
All information that was available in the original XIN files is now provided within the
newest PSI-MI and MITAB files. A rudimentary description of the XIN format can
be found here.
|
|
|
|
Copyright 1999-2017 UCLA. All DIP database records available through this Web Site are freely available under the terms set by the Creative Commons Attribution-NoDerivs License. This means that you are free to copy, distribute, display and make commercial use of these databases in all legislations, provided you give us credit. However, if you intend to distribute data from our database, you must ask us for permission first.
|
|
|
|
|
